Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-107219
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
DVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66564. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
RNA polymerase II (Pol II) is a multi-subunit enzyme responsible for the transcription of protein-coding genes. Transcription initiation requires recruitment of the complete transcription machinery to a promoter via solicitation by activators and chromatin remodeling factors. Pol II can coordinate 10 to 14 subunits. This complex interacts with the promoter regions of genes and a variety of elements and transcription factors. POLR2K (polymerase (RNA) II (DNA directed) polypeptide K), also known as RPB12, RPABC4, RPB7.0, hRPB7.0, hsRPB10a, RPB10alpha or ABC10-alpha, is a 58 amino acid nuclear protein belonging to the archaeal rpoP/eukaryotic RPC10 RNA polymerase subunit family. The gene encoding POLR2K is located on human chromosome 8, which consists of nearly 146 million base pairs, houses more than 800 genes and is associated with a variety of diseases and malignancies.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ABC10-alpha; DNA directed RNA polymerases I, II, and III 7.0 kda polypeptide; DNA-directed RNA polymerase II subunit K; DNA-directed RNA polymerases I, II, and III subunit RPABC4; polymerase (RNA) II (DNA directed) polypeptide K, 7.0kDa; polymerase (RNA) II subunit K; RNA polymerase II 7.0 kDa subunit; RNA polymerases I, II, and III subunit ABC4; RPB10alpha; RPB7.0
Gene Aliases: ABC10-alpha; hRPB7.0; hsRPB10a; POLR2K; RPABC4; RPB10alpha; RPB12; RPB7.0
UniProt ID: (Human) P53803
Entrez Gene ID: (Human) 5440
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support