Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human RAP1 (aa 259-392) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-89492
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
REFEEVVVDESPPDFEIHITMCDDDPPTPEEDSETQPDEEEEEEEEKVSQPEVGAAIKIIRQLMEKFNLDLSTVTQAFLKNSGELEATSAFLASGQRADGYPIWSRQDDIDLQKDDEDTREALVKKFGAQNVAR
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Human Rap1 was the first identified ortholog of the yeast telomeric protein scRap1, which shares 3 conserved sequence motifs in common. HRap1 is located at telomeres and affects telomere length by being recruited to telomeres by TRF2 instead of directly binding to the telomere like scRap1. The hRap1 cDNA codes for a protein of 399 amino acids with approximate molecular weight of 47 kDa. The hRap1 protein does not interact with TRF1. TRF2 is a ubiquitously expressed protein that is implicated in the control of telomere length(1). TRF2, like TRF1 contains a Myb-related DNA binding motif. It binds to duplex TTAGGG repeats and is localized to all human telomeres in metaphase chromosomes. TRF2 is thought to protect chromosome ends by maintaining the correct structure at telomere termini. The use of mutant forms of TRF2 has implicated a role for TRF2 in the prevention of senescence in primary human cells. Recently, it has been shown that inhibition of TRF2 resulted in apoptosis in a subset of mammalian cell types.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: dopamine receptor interacting protein 5; Dopamine receptor-interacting protein 5; hRap1; RAP1 homolog; Repressor/activator protein 1 homolog; tel; telomeric repeat binding factor 2, interacting protein; Telomeric repeat-binding factor 2-interacting protein 1; TERF2-interacting telomeric protein 1; TERF21P; TRF2-interacting telomeric protein 1; TRF2-interacting telomeric RAP1 protein
Gene Aliases: DRIP5; PP8000; RAP1; TERF2IP
UniProt ID: (Human) Q9NYB0
Entrez Gene ID: (Human) 54386
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support