Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
RP-96314
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
SIIQCHILNDKRHILTKDTNNNVAYWDVLKACKVEDLGKVDFEDEIKKRFKMVYVPNWFSVDLKTGMLTITLDESDCFAAWVSAKDAGF
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20° C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
WD-repeats are motifs that are found in a variety of proteins and are characterized by a conserved core of 40-60 amino acids, which commonly form a tertiary propeller structure. While proteins that contain WD-repeats participate in a wide range of cellular functions, they are generally involved in regulatory mechanisms involving signal transduction, apoptosis, transcriptional regulation and cell cycle control. WD repeats serve as sites for protein-protein interaction and some seem to mediate the assembly of protein complexes. With eight WD repeats, WDR48 (WD repeat-containing protein 48), also known as USP1-associated factor 1 and p80, is a 677 amino acid protein that functions to regulate deubiquitinating complexes via activation of USP1, USP12 and USP46. WDR48 enhances deubiquitination by increasing catalytic turnover without increasing the affinity of deubiquitinating enzymes for the substrate. WDR48 is ubiquitously expressed and is mainly localized to the cytoplasm. There are five isoforms of WDR48 that are expressed as a result of alternative splicing events.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: p80; testicular tissue protein Li 224; USP1 associated factor 1; USP1-associated factor 1; WD repeat endosomal protein; WD repeat-containing protein 48
Gene Aliases: KIAA1449; P80; SPG60; UAF1; WDR48
UniProt ID: (Human) Q8TAF3
Entrez Gene ID: (Human) 57599
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support