Search
Invitrogen
Human alpha-1 Antitrypsin Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-98842
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%).
This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
Alpha-1-AT is synthesized in the liver and it acts as an inhibitor of proteases such as trypsin, elastase, chymotrypsin, collagenase, leucocytic proteases, plasmin, and thrombin, which may be released during inflammatory reactions in the lung. In the absence of alpha-1-AT, these enzymes are not inhibited and they may digest pulmonary parenchyma. Alpha-1-AT deficiency is associated with chronic obstructive lung disease (emphysema) and less frequently with hepatic cirrhosis in infants and respiratory distress of the newborn. Increase in alpha-1-AT occurs as an acute phase response to tissue necrosis and inflammation. Serum level of alpha-1-AT is elevated in rheumatoid arthritis, bacterial infections, vasculitis, and carcinomatosis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: a-1 AT; a1-antitrypsin; alpha 1 antitrypsin; alpha-1 antitrypsin; Alpha-1 protease inhibitor; alpha-1 proteinase inhibitor; Alpha-1-antiproteinase; Alpha-1-antitrypsin; alpha-1-antitrypsin (alpha-1-AT); anti-elastase; Digestive Zymogen; epididymis secretory sperm binding protein; MGC23330; MGC9222; protease inhibitor; protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin; Protease Serine 1; proteolytic enzyme inhibitor; serine (or cysteine) proteinase inhibitor, clade A, member 1; Serine Protease 1; Serpin A1; serpin peptidase inhibitor clade A (alpha-1 antiproteinase antitrypsin) member 1 isoform SERPINA1_1; serpin peptidase inhibitor clade A (alpha-1 antiproteinase antitrypsin) member 1 isoform SERPINA1_2; serpin peptidase inhibitor clade A (alpha-1antiproteinase, antitrypsin) member 1; serpin peptidase inhibitor clade A member 1; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; TRP1; TRY1; unnamed protein product
Gene Aliases: A1A; A1AT; AAT; alpha1AT; nNIF; PI; PI1; PRO0684; PRO2209; PRO2275; SERPINA1
UniProt ID: (Human) P01009
Entrez Gene ID: (Human) 5265
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support