Hamburger Menu Button
Thermo Fisher Scientific Logo
Faça o login
Não tem uma conta? Criar Conta​
  • Produtos
    • Consumíveis de Laboratório
    • Equipamentos de Laboratório
    • Instrumentos de Laboratório
    • Clínica & Diagnóstico
    • Cromatografia
    • Espectrômetria de Massas
    • Cultura Celular
    • Análise Celular
    • Anticorpos
    • Biologia Molecular & Análise de Ácidos Nucleicos
    • Produtos Ácidos Nucleicos Específicos de Sequência
    • Veja todas as categorias de produtos
  • Aplicações
    • Cultura Celular e Transfecção
    • Citometria de Fluxo
    • Pesquisa em Oncologia
    • Cromatografia
    • Sequenciamento
    • PCR
    • Soluções Laboratoriais
    • Diagnóstico de Alergias
    • Veja todas as aplicações e técnicas
  • Serviços
    • Serviços de Instrumentos e Equipamentos de Laboratório
    • Serviços Personalizados
    • Serviços de Treinamento
    • Informática de Laboratório em Nível Empresarial
    • Serviços Financeiros e de Arrendamento
    • CDMO & Serviços de Ensaios Clínicos
    • Veja todas as serviços
  • Ajuda e suporte
    • Cadastre-se em nosso site
    • Como fazer o pedido
    • Entre em Contato Conosco
    • Mudança de Localização do Site
    • Veja todos os tópicos de ajuda e suporte
  • Popular
    • Our Instagram
      Nosso Instagram
    • Our Facebook
      Nosso Facebook
    • Blog Behind the Bench
      Blog Behind the Bench
    • Customer Experience Center (CEC)
      Customer Experience Center (CEC)
    • Ecommerce Exclusives
  • Quem atendemos
    • Setor de Biotecnologia
    • Indústria Biofarmacêutica
    • CDMO
    • Diagnósticos Laboratoriais
    • Ciência Industrial e Aplicada
  • Ofertas especiais
  • Fale Conosco
  • Pedido rápido
  • Documentos e certificados
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Fale Conosco
          • Pedido rápido
          • Faça o login
            Faça o login
            Não tem uma conta? Criar Conta​
            • Conta
            • Status do pedido
            • Produtos Customizados & Projetos
          • ELISA Kits ›
          • by Target

          AP36 ELISA Kits

          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated....
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated....
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated. Uncoated ELISA kits include all the necessary reagents to coat your own plates and run your assay with maximum flexibility. Coated ELISA kits...
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated. Uncoated ELISA kits include all the necessary reagents to coat your own plates and run your assay with maximum flexibility. Coated ELISA kits are ready-to-use and quality tested for sensitivity, specificity, precision and lot-to-lot consistency.

          Target Information

          Apelin-36 is a peptide hormone that regulates cardiovascular function, fluid balance, and metabolism. It acts as a ligand for the apelin receptor and has vasodilatory effects, influences fluid balance, and potentially affects energy metabolism. It is produced by various tissues and consists of 36 amino acids (ARVYIHPNSYCFGGHLMDRFRNPTYLPLGCVRF-NH2)

          Synonyms

          Apelin 36; apelin-36

          View more
          View less
          Filters
          Filters
          Filters
          Show Less
          +-2
          Clear All
          1 result
          1 result
          Assay Range
          Sample Volume
          Price
          Compare
          Invitrogen
          Human AP36 Competitive ELISA Kit
          Invitrogen
          Human AP36 Competitive ELISA Kit
          Sensitivity 28.13 pg/mL
          Assay Range 46.88-3,000 pg/mL
          Sample Volume
          Tissue Homogenate
          50 µL
          Cell Lysate
          50 µL
          Plasma
          50 µL
          Time To Result
          2 hr 30 min
          (1 hr 20 min hands-on)
          Price
          Special offer
          Online exclusive
          Online offer:
          Cat # EEL169

          96 Tests

          Not finding what youre looking for? Create Your Own ELISA
          Select Antibodies for your kit

          Select Antibodies for your kit

          Find the exact antibody for your Elisa kit.

          Shop for Antibodies
          Custom Assay Services

          Custom Assay Services

          We provide assay development of your specific protein target.

          Request a quote
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ immunoassay doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Status do pedido
          • Ajuda para pedidos
          • Pedido rápido
          • Supply Center
          • eProcurement
          Suporte Plus Icon Minus Icon
          • Ajuda e suporte
          • Entre em Contato
          • Centros de Suporte Técnico
          • Obter Documentos e Certificados
          • Informe um Problema no Site
          Recursos Plus Icon Minus Icon
          • Centros de aprendizagem
          • Promoções
          • Eventos & Webinars
          • Mídia Sociais
          Sobre a Thermo Fisher Plus Icon Minus Icon
          • Sobre Nós Sobre Nós
          • Carreiras Carreiras
          • Investidores Investidores
          • Sala de Impresa Sala de Impresa
          • Responsabilidade Social Responsabilidade Social
          • Marcas
          • Políticas e avisos
          Nosso Portfólio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Brasil flag icon
          Brasil

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-x75fr:80/100.66.77.4:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline