Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • ELISA Kits ›
          • by Target

          AP36 ELISA Kits

          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated....
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated....
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated. Uncoated ELISA kits include all the necessary reagents to coat your own plates and run your assay with maximum flexibility. Coated ELISA kits...
          ELISA kits are commonly used to measure soluble biomarkers across a variety of research areas. ELISA kits for Human AP36 can be quantified in various samples, including cell lysate, plasma, serum, tissue homogenate.

          Invitrogen ELISA kits exist in two formats: Uncoated and Coated. Uncoated ELISA kits include all the necessary reagents to coat your own plates and run your assay with maximum flexibility. Coated ELISA kits are ready-to-use and quality tested for sensitivity, specificity, precision and lot-to-lot consistency.

          Target Information

          Apelin-36 is a peptide hormone that regulates cardiovascular function, fluid balance, and metabolism. It acts as a ligand for the apelin receptor and has vasodilatory effects, influences fluid balance, and potentially affects energy metabolism. It is produced by various tissues and consists of 36 amino acids (ARVYIHPNSYCFGGHLMDRFRNPTYLPLGCVRF-NH2)

          Synonyms

          Apelin 36; apelin-36

          View more
          View less
          Filters
          Filters
          Filters
          Show Less
          +-2
          Clear All
          1 result
          1 result
          Assay Range
          Sample Volume
          Price
          Compare
          Invitrogen
          Human AP36 Competitive ELISA Kit
          Invitrogen
          Human AP36 Competitive ELISA Kit
          Sensitivity 28.13 pg/mL
          Assay Range 46.88-3,000 pg/mL
          Sample Volume
          Tissue Homogenate
          50 µL
          Cell Lysate
          50 µL
          Plasma
          50 µL
          Time To Result
          2 hr 30 min
          (1 hr 20 min hands-on)
          Price
          Special offer
          Online exclusive
          Online offer:
          Cat # EEL169

          96 Tests

          Not finding what youre looking for? Create Your Own ELISA
          Select Antibodies for your kit

          Select Antibodies for your kit

          Find the exact antibody for your Elisa kit.

          Shop for Antibodies
          Custom Assay Services

          Custom Assay Services

          We provide assay development of your specific protein target.

          Request a quote
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ immunoassay doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-454p7:80/100.66.72.101:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline