Search
Invitrogen
Human ING4 (aa 113-182) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-95605
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
EKQIESSDYDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKTAQKKLKLVRTSPEYGMPSVTFGSVH
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
PBS/1M urea, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111030, PA5-111452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The ING4 gene belongs to the ING (Inhibitor of Growth) family of tumor suppressors. All five members of the ING protein family identified to date contain a highly conserved plant homeodomain (PHD) finger motif at the C-terminal end, which is found in transcription factors that modulate chromatin structure. ING proteins have been shown to form transcriptional complexes leading to activation of responsive genes that mediate a wide range of cellular functions, including growth arrest, DNA repair, gene transcription, apoptosis, and senescence. The candidate tumor suppressor ING4 has a role in brain tumor pathogenesis, and is involved in regulating tumor growth and angiogenesis. Expression of ING4 is reduced in gliomas compared to normal brain tissue, and ING4 reduction correlates with progression from lower to higher grades of tumors. ING4 physically interacts with the p65 (RelA) subunit of NF-kB and represses transcription of NF-kB responsive genes. Inactivating mutations in ING4 transcripts have been described in various human cancer cell lines, and deletion of the ING4 locus has been detected in 10-20% of human breast cancer cell lines and tumors.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: brain my036 protein; candidate tumor suppressor p33 ING1 homolog; Inhibitor of growth protein 4; p29ING4; unnamed protein product
Gene Aliases: ING4; My036; p29ING4
UniProt ID: (Human) Q9UNL4
Entrez Gene ID: (Human) 51147
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support