Search
Invitrogen
Human DSPG3 (aa 198-281) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
RP-97643
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
LRDNKIRQLPELPTTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCNV
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58297. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
The DSPG3 gene is not well-characterized and does not appear in standard genomic databases as a distinct gene or protein coding entity. It is possible that DSPG3 refers to a specific type of dermatan sulfate proteoglycan, given the acronym DSPG, which typically relates to proteoglycans involved in extracellular matrix structure and modulation. Proteoglycans like dermatan sulfate proteoglycans are pivotal in maintaining tissue resilience and regulating cell signaling pathways by interacting with growth factors and cytokines. They contribute to developmental processes and tissue repair mechanisms, playing roles in cellular adhesion, proliferation, and migration. In the context of skeletal and connective tissues, DSPGs influence matrix assembly and modulate biomechanical properties, impacting processes such as angiogenesis and fibrosis. Proteoglycans are known for their importance in disease states, including cancer and fibrosis, where altered expression or structure can affect cellular interactions and disease progression. Further research is needed to understand the specifics of DSPG3's functions and its implications in health and disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Dermatan sulfate proteoglycan 3; DSPG3proteoglycan-lb; Epiphycan; epiphycan proteoglycan; PG-Lb; Proteoglycan-Lb; Small chondroitin/dermatan sulfate proteoglycan; unnamed protein product
Gene Aliases: DSPG3; EPYC; Pg-Lb; PGLB; SLRR3B
UniProt ID: (Human) Q99645
Entrez Gene ID: (Human) 1833
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support