Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human TAF4B (aa 317-463) Control Fragment Recombinant Protein
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
RP-89354
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Wet ice
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56014. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
TAF II p105, also called TAF4B, is a celltype specific transcriptional co-activator that is a component of the TFIID complex. Expressed primarily in B cells and ovarian granulosa cells, TAF II p105 can interact with OCBA/POU2AF1 to activate B cell-specific octamerdependent transcription. Additionally, TAF II p105 plays an important role in co-activating the transcription factor NFkB and is essential for activation of anti-apoptotic genes such as TNFAIP3. TAF II p135, also known as TAF4, TAF2C, TAF2C1, TAF4A or TAFII130, is a 1,085 amino acid subunit of TFIID that accelerates transcriptional activation triggered by thyroid hormone (TR) or retinoic acid (RA). Localized to the nucleus, TAF II p135 contains one TAFH domain and is thought to bind to proteins that contain glutamine-rich domains, such as the transcription factor CREB.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: TAF(II)105; TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa; TAFII-105; TATA box binding protein (TBP)-associated factor 4B; TATA box binding protein (TBP)-associated factor, RNA polymerase II, C2, 105kD; TATA box binding protein associated factor 4b; Transcription initiation factor TFIID 105 kDa subunit; Transcription initiation factor TFIID subunit 4B
Gene Aliases: SPGF13; TAF2C2; TAF4B; TAFII105
UniProt ID: (Human) Q92750
Entrez Gene ID: (Human) 6875
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support